DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33687 and CG33658

DIOPT Version :10

Sequence 1:NP_001027130.2 Gene:CG33687 / 3772322 FlyBaseID:FBgn0053687 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster


Alignment Length:156 Identity:51/156 - (32%)
Similarity:89/156 - (57%) Gaps:3/156 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SHLSFTNLKCEMIDRTFGNFEMCRIKAVNRTHKYIDINLKLYILPINNIMIKLDSKRYTNGYRPF 74
            ||:.|||.||..:.:...:.|.|.:|:||||::|:...:|:..| :|::.:.....:..|||:||
  Fly    26 SHIEFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVLKL-LNSLKVNFGLHQQINGYKPF 89

  Fly    75 FMSLTFDFCKYLKNPNQRSMIFLKEIHSTFINASNLNHTCPYNNDITVNKFWTGNLERAFLRYLP 139
            ..::|.|.|:::|  |.:|.:..|..:....|.|||||:||||:||.:.|..:..:.....:.||
  Fly    90 LYNITIDGCQFMK--NTKSNVVAKYFYDFIRNISNLNHSCPYNHDIIMEKLTSETINSRLPKTLP 152

  Fly   140 VPNGDYAIFSTWYSSNVPRLLVNTFF 165
            .|.|:|...:.|.::...|::...:|
  Fly   153 FPTGNYMFQTYWIANEKYRVVTKIYF 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33687NP_001027130.2 DUF1091 64..147 CDD:461928 30/82 (37%)
CG33658NP_001027209.1 DUF1091 84..160 CDD:461928 30/77 (39%)

Return to query results.
Submit another query.