DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33687 and CG33767

DIOPT Version :10

Sequence 1:NP_001027130.2 Gene:CG33687 / 3772322 FlyBaseID:FBgn0053687 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001027141.1 Gene:CG33767 / 3772047 FlyBaseID:FBgn0053767 Length:188 Species:Drosophila melanogaster


Alignment Length:162 Identity:34/162 - (20%)
Similarity:58/162 - (35%) Gaps:34/162 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 INVILTSHLSFTNL--KCEMIDRTFGNF-----------EMCRIKAVNRTHKYIDINLKLYILPI 55
            :::|....|:.|..  |.......|.||           :|...|.::|       .||:.:   
  Fly    24 VSIIFVHKLAITGAAGKSNFSPTYFENFTLEIQNNTLFMDMTTSKPIHR-------GLKVLL--- 78

  Fly    56 NNIMIKLDSKRYTNGYRPFFMSLTFDFCKYLKNPNQRSMIFLKEIHSTFINASNLNHTCPYNNDI 120
             |..|.||..|   .|:..|..: .|.|..:.  :.|..:| |....:.:...|....||.....
  Fly    79 -NTQISLDKGR---SYQRLFAHI-LDTCGVVS--SVRGNLF-KSWFDSMLKHGNFMVNCPVPAGH 135

  Fly   121 TVNKFWTGNLERAFLRYLPVPNGDYAIFSTWY 152
            ...:.|  .|:...:.:..:| |||.|.:.::
  Fly   136 YFLRDW--KLDSHLVPHYMLP-GDYCITAHFF 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33687NP_001027130.2 DUF1091 64..147 CDD:461928 17/82 (21%)
CG33767NP_001027141.1 DM8 90..180 CDD:214778 17/82 (21%)

Return to query results.
Submit another query.