DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33687 and CG33767

DIOPT Version :9

Sequence 1:NP_001027130.2 Gene:CG33687 / 3772322 FlyBaseID:FBgn0053687 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001027141.1 Gene:CG33767 / 3772047 FlyBaseID:FBgn0053767 Length:188 Species:Drosophila melanogaster


Alignment Length:162 Identity:34/162 - (20%)
Similarity:58/162 - (35%) Gaps:34/162 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 INVILTSHLSFTNL--KCEMIDRTFGNF-----------EMCRIKAVNRTHKYIDINLKLYILPI 55
            :::|....|:.|..  |.......|.||           :|...|.::|       .||:.:   
  Fly    24 VSIIFVHKLAITGAAGKSNFSPTYFENFTLEIQNNTLFMDMTTSKPIHR-------GLKVLL--- 78

  Fly    56 NNIMIKLDSKRYTNGYRPFFMSLTFDFCKYLKNPNQRSMIFLKEIHSTFINASNLNHTCPYNNDI 120
             |..|.||..|   .|:..|..: .|.|..:.  :.|..:| |....:.:...|....||.....
  Fly    79 -NTQISLDKGR---SYQRLFAHI-LDTCGVVS--SVRGNLF-KSWFDSMLKHGNFMVNCPVPAGH 135

  Fly   121 TVNKFWTGNLERAFLRYLPVPNGDYAIFSTWY 152
            ...:.|  .|:...:.:..:| |||.|.:.::
  Fly   136 YFLRDW--KLDSHLVPHYMLP-GDYCITAHFF 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33687NP_001027130.2 DUF1091 64..147 CDD:284008 17/82 (21%)
CG33767NP_001027141.1 DM8 90..180 CDD:214778 17/82 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.