powered by:
Protein Alignment CG33687 and CG33654
DIOPT Version :10
| Sequence 1: | NP_001027130.2 |
Gene: | CG33687 / 3772322 |
FlyBaseID: | FBgn0053687 |
Length: | 169 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001027165.1 |
Gene: | CG33654 / 3771825 |
FlyBaseID: | FBgn0053654 |
Length: | 168 |
Species: | Drosophila melanogaster |
| Alignment Length: | 34 |
Identity: | 9/34 - (26%) |
| Similarity: | 14/34 - (41%) |
Gaps: | 15/34 - (44%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 6 LFSFSCSSFSLVSRRSSYAFRPSFKRLRAQVFLK 39
|.|:.|:.||| .|.::||:
Fly 89 LHSYLCAPFSL---------------QRQKIFLR 107
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG33687 | NP_001027130.2 |
DUF1091 |
64..147 |
CDD:461928 |
|
| CG33654 | NP_001027165.1 |
DUF1091 |
60..147 |
CDD:461928 |
9/34 (26%) |
|
Blue background indicates that the domain is not in
the aligned region.
|
Return to query results.
Submit another query.
