DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33687 and CG14491

DIOPT Version :10

Sequence 1:NP_001027130.2 Gene:CG33687 / 3772322 FlyBaseID:FBgn0053687 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_611276.1 Gene:CG14491 / 37046 FlyBaseID:FBgn0034284 Length:166 Species:Drosophila melanogaster


Alignment Length:159 Identity:41/159 - (25%)
Similarity:63/159 - (39%) Gaps:31/159 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FTNLKCEMIDRTFGNFEMCRI---KAVNRTHKYIDINLKLYILPINNIMIKLD---SKRYTNGYR 72
            |||..|...|.. |...:.:.   |:|.|....|::..|   .|:....:.:.   .:|:.:.:.
  Fly     3 FTNCSCSSEDPE-GMLSLLKCGLSKSVKRPSFNIELQFK---KPVAKFFVNMRIVLPRRFGDDFT 63

  Fly    73 PFFMSLTFDFCKYLKNPNQRSMIFLKEIHSTFINASNLNHTCPYNNDITVNKFWTGNLERAFLRY 137
            .|.:| ..|.|..|.|.||.:.|.|...|..  ..||:...||:..|  ||.:..|  .|:.:..
  Fly    64 LFNLS-GIDGCSLLSNKNQIAFIQLGRKHMD--RFSNIPKRCPWPKD--VNYYIRG--FRSDMAT 121

  Fly   138 LPVPNGDYAIFST----WYSSNVPRLLVN 162
            :|..|     |.|    |:     .|:||
  Fly   122 MPAFN-----FETDMNLWF-----ELVVN 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33687NP_001027130.2 DUF1091 64..147 CDD:461928 23/82 (28%)
CG14491NP_611276.1 DM8 60..150 CDD:214778 28/98 (29%)

Return to query results.
Submit another query.