DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33687 and CG33476

DIOPT Version :10

Sequence 1:NP_001027130.2 Gene:CG33687 / 3772322 FlyBaseID:FBgn0053687 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_995798.2 Gene:CG33476 / 2768727 FlyBaseID:FBgn0053476 Length:165 Species:Drosophila melanogaster


Alignment Length:111 Identity:24/111 - (21%)
Similarity:40/111 - (36%) Gaps:32/111 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KYIDINLKLYILPINNIMIKLDSKRYTNGYRPFFMSLTFDFCKYLKNPNQRSMIFLKEIHSTFIN 106
            |...|:..:.::....:|.|:|:               ||.|::|.||      .:..:..|...
  Fly    55 KAFTIDFAVRVVKTKRVMYKVDN---------------FDGCQFLMNP------LMNRVFGTVYK 98

  Fly   107 ASNLN---HTCPYNNDITVNKFWTGNLERAFLRYLPV--PNGDYAI 147
            ...:|   .:||    |....::..|  ...:..|||  |.|.|.|
  Fly    99 RLVVNGSFFSCP----IKPGVYYIRN--EGSVAMLPVFQPPGRYQI 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33687NP_001027130.2 DUF1091 64..147 CDD:461928 18/87 (21%)
CG33476NP_995798.2 DUF1091 57..138 CDD:461928 22/107 (21%)

Return to query results.
Submit another query.