DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His4:CG33893 and hist1h2a7

DIOPT Version :9

Sequence 1:NP_001027322.1 Gene:His4:CG33893 / 3772314 FlyBaseID:FBgn0053893 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_001373328.1 Gene:hist1h2a7 / 100006331 ZFINID:ZDB-GENE-160113-98 Length:128 Species:Danio rerio


Alignment Length:82 Identity:23/82 - (28%)
Similarity:34/82 - (41%) Gaps:13/82 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGL---IYEETRGVLKVF 62
            |:||||.|   ||..||...:..|..:| .....:.||.|:|...:..|.   :|      |...
Zfish     1 MSGRGKTG---GKARAKAKTRSSRAGLQ-FPVGRVHRLLRKGNYAQRVGAGAPVY------LAAV 55

  Fly    63 LENVIRDAVTYTEHAKR 79
            ||.:..:.:....:|.|
Zfish    56 LEYLTAEILELAGNAAR 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His4:CG33893NP_001027322.1 PLN00035 1..103 CDD:177669 23/82 (28%)
hist1h2a7NP_001373328.1 PTZ00017 1..128 CDD:185399 23/82 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134476
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.