DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33777 and CG14518

DIOPT Version :9

Sequence 1:NP_001027108.1 Gene:CG33777 / 3772311 FlyBaseID:FBgn0053777 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:162 Identity:55/162 - (33%)
Similarity:83/162 - (51%) Gaps:20/162 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LVEKFTNIKCTSLDPEFAHVDHCYLKSVNRTYKYLSLRVNLLQKPVSRIKVNAATWKRYNGYKPS 80
            ::.|.||..|.:.:..:.....|.|::|:|....|::..|||. ||..:.|.|...||.|||||.
  Fly    23 VIFKMTNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLLH-PVHDVIVKARLLKRANGYKPW 86

  Fly    81 LYNFTVDACKFIKNPKSNPVAHYIYRLFKDYSNVNYTCPF-------NDDAIVEKLPISFVNNQV 138
            ||:.:.|.|:||:. ::|.:...::.|||:||.:|:|||:       |.....||||        
  Fly    87 LYSVSFDGCQFIRR-RNNALIRIVWELFKEYSTINHTCPYVGLQQVKNFYLRSEKLP-------- 142

  Fly   139 TSVLPVPSGDYLFSSHWYFYDIKRVTINVYMT 170
               .|:|:|:||....|.|....:...|||.|
  Fly   143 ---TPIPTGEYLLMIDWVFNKKPQAATNVYFT 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33777NP_001027108.1 DUF1091 72..151 CDD:284008 32/85 (38%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 35/101 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472374
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.