DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33777 and CG13589

DIOPT Version :9

Sequence 1:NP_001027108.1 Gene:CG33777 / 3772311 FlyBaseID:FBgn0053777 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster


Alignment Length:166 Identity:56/166 - (33%)
Similarity:89/166 - (53%) Gaps:14/166 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLFFLFLVE----KFTNIKCTSLDPEFAHVDHCYLKSVNRTYKYLSLRVNLLQKPVSRIKVNAAT 70
            :|.||...|    |.||..|.|.:..:..|.:|.||:.:||...|::....:: |...|.::...
  Fly    13 ILGFLVCGEAPLAKMTNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNINATFIE-PAKNIYLHMKM 76

  Fly    71 WKRYNGYKPSLYNFTVDACKFIKNPKSNPVAHYIYRLFKDYSNVNYTCPFNDDAIVEKLPISFVN 135
            .|:.|||||.|:::|.|||:|::. ::.|.|..::.:.|:.|.||:|||:      |.|.:....
  Fly    77 MKKANGYKPFLFDYTFDACEFMRR-RNQPFAKIVWNMIKNVSTVNHTCPY------EGLQMLSDF 134

  Fly   136 NQVTSVLPVPSGDYLFSSHWYFYDIK-RVTINVYMT 170
            :.:...:|:||||||....|.| |.| :...|||.|
  Fly   135 HHIDVPVPLPSGDYLLLLDWIF-DFKPQFATNVYFT 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33777NP_001027108.1 DUF1091 72..151 CDD:284008 29/78 (37%)
CG13589NP_611918.2 DM8 83..171 CDD:214778 35/95 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472365
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.