DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33777 and CG13561

DIOPT Version :9

Sequence 1:NP_001027108.1 Gene:CG33777 / 3772311 FlyBaseID:FBgn0053777 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster


Alignment Length:180 Identity:58/180 - (32%)
Similarity:94/180 - (52%) Gaps:17/180 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSLVYLIQLLFFLFL------VEKFTNIKCTSLDPEFAHVDHCYLKSVNRTYKYLSLRVNLLQK 59
            |.:|..|. |||.|:.      |.|||||:|.|.|..|..|..|.|.:|.|....:|||.|:|:.
  Fly     1 MATLTELF-LLFGLWHILQVQGVAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRW 64

  Fly    60 PVSRIKVNAATWKRYNGYKPSLYNF-TVDACKFIKNPKSNPVAHYIYRLFKDYSNVNYTCPFNDD 123
            |...:.:.....|:.:||||.|||. ..|.|::::. :::|..:.|...|.:.:||| .||...:
  Fly    65 PKGPVSMRMQLLKKASGYKPFLYNICQSDVCEYLEK-RNHPFINIILSSFGNRTNVN-KCPIPPE 127

  Fly   124 AIVE--KLPISFVNNQVTSVLPVPSGDYLFSSHWYFYDIKRVTINVYMTI 171
            .::|  :.|:     :|..::|:|.|||...:.:.|:..:...:.||.|:
  Fly   128 IVLEHFRFPV-----KVLDMMPLPFGDYGLFTTFTFHRSELAQVKVYFTL 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33777NP_001027108.1 DUF1091 72..151 CDD:284008 26/81 (32%)
CG13561NP_611830.3 DM8 82..173 CDD:214778 28/98 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472373
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.