DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33777 and CG33773

DIOPT Version :9

Sequence 1:NP_001027108.1 Gene:CG33777 / 3772311 FlyBaseID:FBgn0053777 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_001027213.1 Gene:CG33773 / 3772436 FlyBaseID:FBgn0053773 Length:179 Species:Drosophila melanogaster


Alignment Length:174 Identity:82/174 - (47%)
Similarity:115/174 - (66%) Gaps:13/174 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIQLLFFLFLVE-----KFTNIKCTSLDPEFAHVDHCYLKSVNRTYKYLSLRVNLLQKPVSRIKV 66
            ::.:|.|..:::     :|||:.||:.|......::|.|||:||:|||:|.:..|.|.|:.|:||
  Fly     9 ILAILIFYSIIKTNSRFEFTNLNCTAFDLRVGEFENCNLKSINRSYKYVSGKYKLNQIPLPRMKV 73

  Fly    67 NAATWKRYNGYKPSLYNFTVDACKFIKNPKSNPVAHYIYRLFKDYSNVNYTCPFNDDAIVEKLPI 131
            |...|||.|||:|.|||.|.|||||::|||||||..||:..|..|||:|::||:..|.|||:|||
  Fly    74 NFIMWKRLNGYRPFLYNITADACKFVENPKSNPVLKYIFDSFSAYSNMNHSCPYTSDLIVERLPI 138

  Fly   132 SFVNNQVTSVLPVPSGDYLFSSHWYFYDIKRVTI----NVYMTI 171
            .|:|.:||.:||.|.|:|||..|:    .:|.:|    .||.||
  Fly   139 GFMNLRVTEILPFPEGNYLFEFHF----SRRKSIFASTQVYFTI 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33777NP_001027108.1 DUF1091 72..151 CDD:284008 47/78 (60%)
CG33773NP_001027213.1 DUF1091 73..158 CDD:284008 50/84 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472061
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.940

Return to query results.
Submit another query.