DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33777 and CG33764

DIOPT Version :9

Sequence 1:NP_001027108.1 Gene:CG33777 / 3772311 FlyBaseID:FBgn0053777 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_001027107.1 Gene:CG33764 / 3772289 FlyBaseID:FBgn0053764 Length:180 Species:Drosophila melanogaster


Alignment Length:171 Identity:85/171 - (49%)
Similarity:117/171 - (68%) Gaps:0/171 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSLVYLIQLLFFLFLVEKFTNIKCTSLDPEFAHVDHCYLKSVNRTYKYLSLRVNLLQKPVSRIK 65
            :.||:.|...:..::.|.|||||:|.|||.:||..|..:||||||:|||:|::|.||:.|||::|
  Fly     9 VASLILLTYYITEIYSVVKFTNIQCQSLDRDFALFDSWFLKSVNRSYKYVSVKVKLLKIPVSKVK 73

  Fly    66 VNAATWKRYNGYKPSLYNFTVDACKFIKNPKSNPVAHYIYRLFKDYSNVNYTCPFNDDAIVEKLP 130
            |....:||.|||.|.|||.:.|||:|:.:|..||||.|.|..||||||:|::|||:.|.|::|:|
  Fly    74 VRFGLYKRVNGYMPFLYNMSFDACRFLTSPNPNPVALYFYNFFKDYSNINHSCPFDHDIILDKMP 138

  Fly   131 ISFVNNQVTSVLPVPSGDYLFSSHWYFYDIKRVTINVYMTI 171
            ...:||:||.:||.|.|.|:...||..|||.|.....|.|:
  Fly   139 YHSINNKVTKILPFPEGKYMIEMHWIAYDIDRAITKFYWTL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33777NP_001027108.1 DUF1091 72..151 CDD:284008 43/78 (55%)
CG33764NP_001027107.1 DUF1091 74..159 CDD:284008 44/84 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472085
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.