DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33777 and CG33920

DIOPT Version :9

Sequence 1:NP_001027108.1 Gene:CG33777 / 3772311 FlyBaseID:FBgn0053777 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster


Alignment Length:176 Identity:85/176 - (48%)
Similarity:125/176 - (71%) Gaps:12/176 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVYLIQLLFFLFLVE-----KFTNIKCTSLDPEFAHVDHCYLKSVNRTYKYLSLRVNLLQKPVSR 63
            ||.|:.|  .:.:||     :||||.|.|||.:|:..::||:|||||:|||:|::..|.:.|:: 
  Fly     8 LVALLAL--SISIVEISSKFEFTNIMCNSLDKQFSDFEYCYIKSVNRSYKYVSIKAKLFKTPIT- 69

  Fly    64 IKVNAATWKR---YNGYKPSLYNFTVDACKFIKNPKSNPVAHYIYRLFKDYSNVNYTCPFNDDAI 125
             |:|....||   ||||:|.::|.|:|||:|:.|.||||:|.|:|...:.::|:|:.||::.|.:
  Fly    70 -KINGVILKRFNGYNGYRPFMFNITLDACRFMNNTKSNPIASYLYDFIRPFTNMNHNCPYDHDLV 133

  Fly   126 VEKLPISFVNNQVTSVLPVPSGDYLFSSHWYFYDIKRVTINVYMTI 171
            :|||||.|||:|||.|||||.||||:.::|..|||:|..:.||.||
  Fly   134 IEKLPIHFVNHQVTKVLPVPEGDYLYETNWMAYDIRRAVVKVYGTI 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33777NP_001027108.1 DUF1091 72..151 CDD:284008 45/81 (56%)
CG33920NP_001027214.1 DUF1091 71..158 CDD:284008 45/86 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
66.060

Return to query results.
Submit another query.