DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33777 and CG33927

DIOPT Version :9

Sequence 1:NP_001027108.1 Gene:CG33777 / 3772311 FlyBaseID:FBgn0053777 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster


Alignment Length:165 Identity:56/165 - (33%)
Similarity:91/165 - (55%) Gaps:17/165 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSLVYLIQLLFFLFLVE---------KFTNIKCTSLDPEFAHVDHCYLKSVNRTYKYLSLRVNL 56
            :.:::||:  |||...:|         ||||..|.|::..:..|..|.||::.|....||....:
  Fly     4 VSNVLYLV--LFFRIALELGSINASRFKFTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGTV 66

  Fly    57 LQKPVSRIKVNAATWKRYNGYKPSLYNFTVDACKFIKNPKSNPVAHYIYRLFKDYSNVNYTCPFN 121
            | |.:|:.:|:...:||.||:||.|||.|.|.|:|::.|...||. .::.|.|.:||:|:|||:.
  Fly    67 L-KTISKFRVHGQIFKRANGFKPWLYNITFDGCRFLRKPYEAPVI-IVFNLLKSFSNLNFTCPYM 129

  Fly   122 DDAIVEKLPISFVNNQVTSVLPVPSGDYLFSSHWY 156
            ..  |..:.:..:..|:.  :|:|:|:||....||
  Fly   130 GP--VHIMGLHIIGEQIP--VPLPTGEYLIQIKWY 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33777NP_001027108.1 DUF1091 72..151 CDD:284008 30/78 (38%)
CG33927NP_001027147.1 DUF1091 75..155 CDD:284008 31/84 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472369
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.