DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33777 and CG33703

DIOPT Version :9

Sequence 1:NP_001027108.1 Gene:CG33777 / 3772311 FlyBaseID:FBgn0053777 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_001027119.1 Gene:CG33703 / 3771760 FlyBaseID:FBgn0053703 Length:181 Species:Drosophila melanogaster


Alignment Length:180 Identity:45/180 - (25%)
Similarity:74/180 - (41%) Gaps:24/180 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVYLIQLLFFL-------FLVEKFTNIKCTSLDPEFAHVDHCYL--KSVNRTYKYLSLRVNLLQK 59
            |..::.||..|       |.|.|   ::|.||||.|.:...|.:  :...|...|:| .|.|.:.
  Fly     6 LSLVLPLLIILDCSQGRVFRVSK---MECRSLDPSFTYFKTCKVVRRENGRAALYVS-EVFLYKD 66

  Fly    60 PVSRIKVNAATWKRYNGYKPSLYNFTVDACKFIKNPKSNPVAHYIYRLFKDYSNVNYTCPFNDDA 124
            |:..|.:|...::.....:....|.|:|.|.|.:...::....::.......||:|.|||...: 
  Fly    67 PIDDIVLNLGVFRIAKNRRFQFLNETLDYCLFSRQYLASGFFGFLMTPLLRISNLNATCPLQQN- 130

  Fly   125 IVEKLPISF----VNNQVTSVLPVPSGDYLFSSHWYFYDIKRVTINVYMT 170
                  |:|    |:......:|:|:|.|:|..........|..:.||.|
  Fly   131 ------ITFNGFSVDENTIKEIPIPNGVYMFHLRSSLMKKWRTDVKVYAT 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33777NP_001027108.1 DUF1091 72..151 CDD:284008 18/82 (22%)
CG33703NP_001027119.1 DUF1091 73..155 CDD:284008 19/88 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.