DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33777 and CG14491

DIOPT Version :10

Sequence 1:NP_001027108.1 Gene:CG33777 / 3772311 FlyBaseID:FBgn0053777 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_611276.1 Gene:CG14491 / 37046 FlyBaseID:FBgn0034284 Length:166 Species:Drosophila melanogaster


Alignment Length:111 Identity:37/111 - (33%)
Similarity:53/111 - (47%) Gaps:13/111 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FTNIKCTSLDPE-FAHVDHCYL-KSVNRTYKYLSLRVNL-LQKPVSRIKVN-AATWKRYNGYKPS 80
            |||..|:|.||| ...:..|.| |||.|.    |..:.| .:|||::..|| .....|..|...:
  Fly     3 FTNCSCSSEDPEGMLSLLKCGLSKSVKRP----SFNIELQFKKPVAKFFVNMRIVLPRRFGDDFT 63

  Fly    81 LYNFT-VDACKFIKNPKSNPVAH-YIYRLFKD-YSNVNYTCPFNDD 123
            |:|.: :|.|..:.|  .|.:|. .:.|...| :||:...||:..|
  Fly    64 LFNLSGIDGCSLLSN--KNQIAFIQLGRKHMDRFSNIPKRCPWPKD 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33777NP_001027108.1 DUF1091 66..151 CDD:461928 18/62 (29%)
CG14491NP_611276.1 DM8 60..150 CDD:214778 14/50 (28%)

Return to query results.
Submit another query.