DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33777 and CG30050

DIOPT Version :9

Sequence 1:NP_001027108.1 Gene:CG33777 / 3772311 FlyBaseID:FBgn0053777 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_725159.2 Gene:CG30050 / 246417 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster


Alignment Length:156 Identity:32/156 - (20%)
Similarity:61/156 - (39%) Gaps:30/156 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FTNIKCTSLDPEFAHVDHCYLKSVNRTYKYLSLRVNLLQKP---VSRIKVNAATWKRYNGYKPSL 81
            |.|:.|..:.|:            |||   :...||::|:.   ...::|:....|:   ....:
  Fly    45 FANLYCRIIPPK------------NRT---MEASVNIMQQLSVFSGSLRVSIPNAKK---VITQI 91

  Fly    82 YNFTVDACKFIKNPKSNPVAHYIYRLFKDYSNVN-YTCPFNDDAIVEKLPISFVNNQVTSVLPVP 145
            ::.|.|.||.::..|...:...:.......||.. :.|||.......:      |..||.:.|:.
  Fly    92 FDITFDVCKVLRERKRKILIDLLVNTLAKNSNAKAWRCPFPKGKFESR------NISVTDLPPML 150

  Fly   146 SGDYLFSSHWYFYDIKRVTINVYMTI 171
            :....|.:..:|  |.:|.|.:.:|:
  Fly   151 TESEFFVNLDFF--IPKVAIAMNVTL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33777NP_001027108.1 DUF1091 72..151 CDD:284008 15/79 (19%)
CG30050NP_725159.2 DM8 90..177 CDD:214778 20/93 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.