DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10731 and Dmac2l

DIOPT Version :9

Sequence 1:NP_001027422.1 Gene:CG10731 / 3772305 FlyBaseID:FBgn0034081 Length:203 Species:Drosophila melanogaster
Sequence 2:XP_006516243.1 Gene:Dmac2l / 68055 MGIID:1915305 Length:207 Species:Mus musculus


Alignment Length:184 Identity:58/184 - (31%)
Similarity:103/184 - (55%) Gaps:9/184 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLLNKLPRITQLLARDP--KDQRGIWGYVAVAFNQVDAERLSKVGANRLCAEWIIKNGGGVRFV 63
            |::..|:.|....|.:.|  .|.|..|.::...||:||.|||..||.:|..:||:::.|..||:.
Mouse     1 MMMFGKISRQLCSLKKIPWSCDSRYFWEWLNTVFNKVDYERLRDVGPDRAASEWLLRCGAKVRYC 65

  Fly    64 ESPSRLWKDYNSLPGEN-TQFCIKVVDASNSSIMKIGLEHLKDCRSIDTVIFHNCKHLENDGLE- 126
            .....| .|||:|||.: .::.|:.:||::|.||.|||:|:.....::.:....|.::|::.|: 
Mouse    66 GHQKWL-HDYNTLPGSSIDRYKIQAIDATDSCIMDIGLDHMVGLEHVEKITLCKCHYIEDNCLQR 129

  Fly   127 --GLHHISSSLQRLQVSGCYNITDSGLAVIG--ELKNLRQLLIFDMIFVKNMEA 176
              .|.::..||..|::..|.|:||:|:..:.  .::.|..|.:||::.|...|:
Mouse   130 LSQLENLRKSLLELEIIACGNVTDNGVIALRHFSIQTLGPLGVFDLMAVDPSES 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10731NP_001027422.1 AMN1 <91..167 CDD:187754 21/80 (26%)
leucine-rich repeat 109..134 CDD:275381 4/27 (15%)
leucine-rich repeat 135..159 CDD:275381 7/25 (28%)
Dmac2lXP_006516243.1 AMN1 97..>159 CDD:187754 18/61 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831925
Domainoid 1 1.000 115 1.000 Domainoid score I6048
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12232
Inparanoid 1 1.050 115 1.000 Inparanoid score I4819
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45531
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007106
OrthoInspector 1 1.000 - - oto92913
orthoMCL 1 0.900 - - OOG6_107545
Panther 1 1.100 - - LDO PTHR13382
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4273
SonicParanoid 1 1.000 - - X5196
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.930

Return to query results.
Submit another query.