DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10731 and R02D5.8

DIOPT Version :9

Sequence 1:NP_001027422.1 Gene:CG10731 / 3772305 FlyBaseID:FBgn0034081 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001122981.1 Gene:R02D5.8 / 6418757 WormBaseID:WBGene00050937 Length:252 Species:Caenorhabditis elegans


Alignment Length:191 Identity:46/191 - (24%)
Similarity:90/191 - (47%) Gaps:35/191 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NQVDAERLSKVGANRLCAEWIIKNGG-GVRF----VESPSRLWKDY------NSLP--------- 77
            |:.:.:|:.::|.:..|.||:::.|. .||.    :.:..|..:||      .::|         
 Worm    43 NKYNEKRVHEIGPDLACLEWLMECGATSVRMSDGQIITRQREMRDYIPHALSENIPSSDRPALQV 107

  Fly    78 ---GENTQF------CIKVVDASNSSIMKIGLEHLKDCRSIDTVIFHNCKHLENDGLEGL--HHI 131
               |...|:      .|..||||:|:|...|..:|:|.|.|:.:..:.|.:..::.|:.|  ...
 Worm   108 GDIGYEKQWPNAPHTWIVEVDASDSAIANEGFTYLRDVRRIEKLKLNFCDYFGDEALKFLAQGRP 172

  Fly   132 SSSLQRLQV--SGCYNITDSGLAVIGELKNLRQLLIFDMIFVKNMEAVAASLKKQLPSCDI 190
            :.:|..|::  :.|  |||..:..:.:||:||:...:.:.:|.:.:.....||..||.|::
 Worm   173 AQTLTDLEIVLNPC--ITDGAVYWLLKLKSLRRAHFYFLPYVAHRQGFIRQLKMALPRCNV 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10731NP_001027422.1 AMN1 <91..167 CDD:187754 21/79 (27%)
leucine-rich repeat 109..134 CDD:275381 4/26 (15%)
leucine-rich repeat 135..159 CDD:275381 7/25 (28%)
R02D5.8NP_001122981.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45531
OrthoDB 1 1.010 - - D1395428at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107545
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.