DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10731 and DMAC2

DIOPT Version :9

Sequence 1:NP_001027422.1 Gene:CG10731 / 3772305 FlyBaseID:FBgn0034081 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001161339.1 Gene:DMAC2 / 55101 HGNCID:25496 Length:263 Species:Homo sapiens


Alignment Length:214 Identity:58/214 - (27%)
Similarity:97/214 - (45%) Gaps:32/214 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KDQRGIWGYVAVAFNQVDAER-------LSKVGANRLCAEW--------------IIKNGGGVRF 62
            |.:|.|..::...|..|:|.|       :.||........|              |:|.||.|:|
Human    42 KKKRTILQFLTNYFYDVEALRDYLLQREMYKVHEKNRSYTWLEKQHGPYGAGAFFILKQGGAVKF 106

  Fly    63 VESPSRLW---KDYNSLPGENTQFC---IKVVDASNSSIMKIGLEHLKDCRSIDTVIFHNCKHLE 121
            .:   :.|   ..|.....|...||   ::.|||.:..|...||::|...:.:.::....|.|::
Human   107 RD---KEWIRPDKYGHFSQEFWNFCEVPVEAVDAGDCDINYEGLDNLLRLKELQSLSLQRCCHVD 168

  Fly   122 NDGLEGLHHISSSLQRLQVSGCYNITDSGLAVIGELKNLRQLLIFDMIFVKNMEAVAASLKKQLP 186
            :..|..|:.::.|||.|.::||..|::.|||.:..|:|||:|.|.|:..|.|.......:::.||
Human   169 DWCLSRLYPLADSLQELSLAGCPRISERGLACLHHLQNLRRLDISDLPAVSNPGLTQILVEEMLP 233

  Fly   187 SCDIKATKM--GLTLKPKE 203
            :|::.....  ||...|:|
Human   234 NCEVVGVDWAEGLKSGPEE 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10731NP_001027422.1 AMN1 <91..167 CDD:187754 24/75 (32%)
leucine-rich repeat 109..134 CDD:275381 4/24 (17%)
leucine-rich repeat 135..159 CDD:275381 10/23 (43%)
DMAC2NP_001161339.1 leucine-rich repeat 132..155 CDD:275381 7/22 (32%)
AMN1 140..>201 CDD:187754 18/60 (30%)
leucine-rich repeat 156..181 CDD:275381 4/24 (17%)
leucine-rich repeat 182..206 CDD:275381 10/23 (43%)
leucine-rich repeat 207..227 CDD:275381 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.