DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10731 and dmac2l

DIOPT Version :9

Sequence 1:NP_001027422.1 Gene:CG10731 / 3772305 FlyBaseID:FBgn0034081 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001017243.1 Gene:dmac2l / 549997 XenbaseID:XB-GENE-978777 Length:199 Species:Xenopus tropicalis


Alignment Length:174 Identity:53/174 - (30%)
Similarity:96/174 - (55%) Gaps:5/174 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RGIWGYVAVAFNQVDAERLSKVGANRLCAEWIIKNGGGVRFVESPSRLWKDYNSLP-GENTQFCI 85
            |..||::...||:||.||:...|.:|..:||:::.|..||: :...|..:|||.|| |...:|.|
 Frog    23 RYFWGWLNAVFNKVDYERIKDFGPDRAASEWLLRCGAHVRY-KGFERWQQDYNGLPTGPLGKFKI 86

  Fly    86 KVVDASNSSIMKIGLEHLKDCRSIDTVIFHNCKHLENDGLE---GLHHISSSLQRLQVSGCYNIT 147
            :.::|::|.||..|.:||.....::.:....|.::|:..||   .:.::.:||:||::..|.|:|
 Frog    87 QAINATDSCIMYRGFDHLDGLEHVEEIKLCKCIYIEDTCLERMSKIENLQNSLRRLEIISCGNVT 151

  Fly   148 DSGLAVIGELKNLRQLLIFDMIFVKNMEAVAASLKKQLPSCDIK 191
            |.|:..:..|:||..|.:.|:..:...:.....|:...||..::
 Frog   152 DRGIIALNTLRNLEYLFLSDLPGITKKQTTVEMLQTANPSLHVE 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10731NP_001027422.1 AMN1 <91..167 CDD:187754 23/78 (29%)
leucine-rich repeat 109..134 CDD:275381 4/27 (15%)
leucine-rich repeat 135..159 CDD:275381 9/23 (39%)
dmac2lNP_001017243.1 leucine-rich repeat 110..137 CDD:275381 4/26 (15%)
LRR_CC 138..158 CDD:197685 9/19 (47%)
leucine-rich repeat 139..163 CDD:275381 9/23 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I7037
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H12232
Inparanoid 1 1.050 99 1.000 Inparanoid score I4881
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1395428at2759
OrthoFinder 1 1.000 - - FOG0007106
OrthoInspector 1 1.000 - - oto103178
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4273
SonicParanoid 1 1.000 - - X5196
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.