DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10731 and CG4042

DIOPT Version :9

Sequence 1:NP_001027422.1 Gene:CG10731 / 3772305 FlyBaseID:FBgn0034081 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001262121.1 Gene:CG4042 / 40291 FlyBaseID:FBgn0037018 Length:284 Species:Drosophila melanogaster


Alignment Length:161 Identity:44/161 - (27%)
Similarity:77/161 - (47%) Gaps:12/161 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ERLSKVGANRLCAEWIIKNGGGVRFVESP--SRLWKDYN-SLPGE-NTQFCIKVVDASNSSIMKI 98
            ||...:||....|.:|:..||.|:|:...  .|..||.. .||.: :.::.::.:...|..:...
  Fly   120 ERHKILGAELAAAHFILYRGGAVKFINDTHWRRASKDGEFKLPNKFDPRYKVEALRCDNMELYYE 184

  Fly    99 GLEHLKDCRSIDTVIFHNCKHLENDGLEGLHHISS----SLQRLQVSGCYNITDSGLAVIGELKN 159
            |||:|:...|:..:.|||.|..::..|:   .||.    :|:.|.:| |..||.:|||.:.....
  Fly   185 GLENLRCLDSLKFLSFHNVKSFDDWCLD---RISGGGFPNLEVLDLS-CTQITSNGLACLYRFPK 245

  Fly   160 LRQLLIFDMIFVKNMEAVAASLKKQLPSCDI 190
            |:.|::.|......:|.....|::.:|:..|
  Fly   246 LKLLILNDPKETLELELSTVMLEEAMPALKI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10731NP_001027422.1 AMN1 <91..167 CDD:187754 24/79 (30%)
leucine-rich repeat 109..134 CDD:275381 7/28 (25%)
leucine-rich repeat 135..159 CDD:275381 9/23 (39%)
CG4042NP_001262121.1 leucine-rich repeat 192..221 CDD:275381 8/31 (26%)
leucine-rich repeat 222..245 CDD:275381 9/23 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4273
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.