DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10731 and dmac2l

DIOPT Version :9

Sequence 1:NP_001027422.1 Gene:CG10731 / 3772305 FlyBaseID:FBgn0034081 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_956512.1 Gene:dmac2l / 393187 ZFINID:ZDB-GENE-040426-959 Length:199 Species:Danio rerio


Alignment Length:175 Identity:58/175 - (33%)
Similarity:96/175 - (54%) Gaps:5/175 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QRGIWGYVAVAFNQVDAERLSKVGANRLCAEWIIKNGGGVRFVESPSRLWKDYNSLP-GENTQFC 84
            :|..||::...||:||.||:..||.:|..|||:::.|..||| ....|...|||.|| |...::.
Zfish    22 RREFWGWLNAVFNKVDYERIKAVGPDRAAAEWLLRCGAKVRF-RGFDRWQHDYNGLPTGPLGRYR 85

  Fly    85 IKVVDASNSSIMKIGLEHLKDCRSIDTVIFHNCKHLENDGLEGLHHISS---SLQRLQVSGCYNI 146
            |:.:||:.|.||..|.:||:....::.:..:.|.::|:..||.|..|.:   :::::.|..|.|:
Zfish    86 IEAIDATESCIMYRGFDHLEGLEHVEEIRLNKCIYIEDACLERLGQIKTLQDTVKQMTVVSCGNV 150

  Fly   147 TDSGLAVIGELKNLRQLLIFDMIFVKNMEAVAASLKKQLPSCDIK 191
            ||.||..:..|..|.:|.:.|:..||:.:.....|:..||...|:
Zfish   151 TDKGLIALHHLGKLERLFLSDLPGVKDKDQTVDRLQAALPRLTIE 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10731NP_001027422.1 AMN1 <91..167 CDD:187754 22/78 (28%)
leucine-rich repeat 109..134 CDD:275381 6/27 (22%)
leucine-rich repeat 135..159 CDD:275381 8/23 (35%)
dmac2lNP_956512.1 leucine-rich repeat 111..129 CDD:275381 4/17 (24%)
leucine-rich repeat 132..163 CDD:275381 9/30 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574771
Domainoid 1 1.000 100 1.000 Domainoid score I6949
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12232
Inparanoid 1 1.050 101 1.000 Inparanoid score I4981
OMA 1 1.010 - - QHG45531
OrthoDB 1 1.010 - - D1395428at2759
OrthoFinder 1 1.000 - - FOG0007106
OrthoInspector 1 1.000 - - oto40174
orthoMCL 1 0.900 - - OOG6_107545
Panther 1 1.100 - - LDO PTHR13382
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5196
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.