DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10731 and C05C8.1

DIOPT Version :9

Sequence 1:NP_001027422.1 Gene:CG10731 / 3772305 FlyBaseID:FBgn0034081 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_504842.1 Gene:C05C8.1 / 179119 WormBaseID:WBGene00015460 Length:200 Species:Caenorhabditis elegans


Alignment Length:195 Identity:59/195 - (30%)
Similarity:96/195 - (49%) Gaps:18/195 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RITQLLARDPKDQRGIWG--YVAVAFNQVDAERLSKVGANRLCAEWIIKNGGGVRFVESPSRLWK 71
            :.||.|.     |..|.|  :|...||..|.:|:.:|||:|..||||::.||.::| ...:..::
 Worm     9 KFTQALG-----QHNIPGLRWVLEGFNNYDVQRVKEVGADRAAAEWIVRCGGSIKF-NQIAETFE 67

  Fly    72 DYNSLPGENTQF---------CIKVVDASNSSIMKIGLEHLKDCRSIDTVIFHNCKHLENDGLEG 127
            |||.|.....|.         .::.:.|.|:|:...|..|.:....|.:|.|..||:|.:.|||.
 Worm    68 DYNCLVKRTAQLDPRLSQDNVTLETIRAVNASVTGFGCRHFEGLTGIKSVYFIKCKNLHDFGLEY 132

  Fly   128 L-HHISSSLQRLQVSGCYNITDSGLAVIGELKNLRQLLIFDMIFVKNMEAVAASLKKQLPSCDIK 191
            : :|:...|:.|.:..|..||:.||..:.:...|.:|::.::..|...|.|...|:..||..||:
 Worm   133 MGNHVGGHLKTLHIEECRRITEFGLEHLTKFSALDKLVLRNLKSVHGKEKVQEKLRGALPKTDIQ 197

  Fly   192  191
             Worm   198  197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10731NP_001027422.1 AMN1 <91..167 CDD:187754 23/76 (30%)
leucine-rich repeat 109..134 CDD:275381 10/25 (40%)
leucine-rich repeat 135..159 CDD:275381 7/23 (30%)
C05C8.1NP_504842.1 leucine-rich repeat 90..113 CDD:275381 5/22 (23%)
leucine-rich repeat 141..165 CDD:275381 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156659
Domainoid 1 1.000 89 1.000 Domainoid score I4956
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I3683
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45531
OrthoDB 1 1.010 - - D1395428at2759
OrthoFinder 1 1.000 - - FOG0007106
OrthoInspector 1 1.000 - - oto17539
orthoMCL 1 0.900 - - OOG6_107545
Panther 1 1.100 - - LDO PTHR13382
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4273
SonicParanoid 1 1.000 - - X5196
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.940

Return to query results.
Submit another query.