DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10731 and dmac2

DIOPT Version :9

Sequence 1:NP_001027422.1 Gene:CG10731 / 3772305 FlyBaseID:FBgn0034081 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001373217.1 Gene:dmac2 / 100331141 ZFINID:ZDB-GENE-121214-335 Length:259 Species:Danio rerio


Alignment Length:176 Identity:45/176 - (25%)
Similarity:77/176 - (43%) Gaps:17/176 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KDQRGIWGYVAVAFNQVDAERLSKVGANRLCAEWIIKNGGGVRFVESPSRLWKD----YNSLPGE 79
            |.|...:|||...:.       :::||    |.:|:...|..||.........|    ::.:...
Zfish    65 KFQNKYFGYVQKRYG-------AQIGA----AYYILAIKGSFRFAGQSQWFRPDSTGMFSFMRSP 118

  Fly    80 NTQFCIKVVDASNSSIMKIGLEHLKDCRSIDTVIFHNCKHLENDGLEGLHHISSSLQRLQVSGCY 144
            :.|  |:.||.|.:.|...||.:|.....:.|:....|..:::..|..||....||..|.:|.|.
Zfish   119 HGQ--IEEVDLSGTLINLNGLGNLISQNKLKTLSLRGCPEVDDWFLARLHVFRDSLVELDLSDCT 181

  Fly   145 NITDSGLAVIGELKNLRQLLIFDMIFVKNMEAVAASLKKQLPSCDI 190
            ::|..|||.:..|:.|::|.|..:..::....|...|::.||.|.:
Zfish   182 HVTVGGLAALQNLRKLKRLDISGLPRLQCPGLVRILLEEMLPHCQV 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10731NP_001027422.1 AMN1 <91..167 CDD:187754 23/75 (31%)
leucine-rich repeat 109..134 CDD:275381 5/24 (21%)
leucine-rich repeat 135..159 CDD:275381 9/23 (39%)
dmac2NP_001373217.1 AMN1 119..>203 CDD:187754 26/85 (31%)
leucine-rich repeat 122..139 CDD:275381 7/16 (44%)
leucine-rich repeat 146..171 CDD:275381 5/24 (21%)
leucine-rich repeat 172..196 CDD:275381 9/23 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.