Sequence 1: | NP_001027422.1 | Gene: | CG10731 / 3772305 | FlyBaseID: | FBgn0034081 | Length: | 203 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001373217.1 | Gene: | dmac2 / 100331141 | ZFINID: | ZDB-GENE-121214-335 | Length: | 259 | Species: | Danio rerio |
Alignment Length: | 176 | Identity: | 45/176 - (25%) |
---|---|---|---|
Similarity: | 77/176 - (43%) | Gaps: | 17/176 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 KDQRGIWGYVAVAFNQVDAERLSKVGANRLCAEWIIKNGGGVRFVESPSRLWKD----YNSLPGE 79
Fly 80 NTQFCIKVVDASNSSIMKIGLEHLKDCRSIDTVIFHNCKHLENDGLEGLHHISSSLQRLQVSGCY 144
Fly 145 NITDSGLAVIGELKNLRQLLIFDMIFVKNMEAVAASLKKQLPSCDI 190 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10731 | NP_001027422.1 | AMN1 | <91..167 | CDD:187754 | 23/75 (31%) |
leucine-rich repeat | 109..134 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 135..159 | CDD:275381 | 9/23 (39%) | ||
dmac2 | NP_001373217.1 | AMN1 | 119..>203 | CDD:187754 | 26/85 (31%) |
leucine-rich repeat | 122..139 | CDD:275381 | 7/16 (44%) | ||
leucine-rich repeat | 146..171 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 172..196 | CDD:275381 | 9/23 (39%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |