DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33910 and HTB1

DIOPT Version :10

Sequence 1:NP_001027283.1 Gene:His2B:CG33910 / 3772299 FlyBaseID:FBgn0053910 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_172258.1 Gene:HTB1 / 837293 AraportID:AT1G07790 Length:148 Species:Arabidopsis thaliana


Alignment Length:130 Identity:90/130 - (69%)
Similarity:103/130 - (79%) Gaps:10/130 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PKTSGKAAKKA-----GKAQKNITKT---DKKKKRKRK--ESYAIYIYKVLKQVHPDTGISSKAM 57
            |....|||:||     .||.|.:...   ||||||.:|  |:|.|||:|||||||||.|||||||
plant    19 PVEENKAAEKAPAEKKPKAGKKLPPKEAGDKKKKRSKKNVETYKIYIFKVLKQVHPDIGISSKAM 83

  Fly    58 SIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 122
            .|||||:|||||::|.|:|:||.|||:.|||||||||||||:|||||||||||||||||||:|||
plant    84 GIMNSFINDIFEKLAQESSKLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 148

  Fly   123  122
            plant   149  148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33910NP_001027283.1 HFD_H2B 33..120 CDD:467035 71/86 (83%)
HTB1NP_172258.1 valS <1..46 CDD:237855 9/26 (35%)
HFD_H2B 57..146 CDD:467035 71/88 (81%)

Return to query results.
Submit another query.