DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33910 and Hist2h2be

DIOPT Version :9

Sequence 1:NP_001027283.1 Gene:His2B:CG33910 / 3772299 FlyBaseID:FBgn0053910 Length:123 Species:Drosophila melanogaster
Sequence 2:XP_227459.1 Gene:Hist2h2be / 295274 RGDID:1562346 Length:126 Species:Rattus norvegicus


Alignment Length:122 Identity:100/122 - (81%)
Similarity:104/122 - (85%) Gaps:6/122 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PPKTSGKAAKKAGKAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVND 66
            |.|.|.||..|..|      |..||:||.|||||:||:||||||||||||||||||.||||||||
  Rat    11 PKKGSKKAVTKGQK------KDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVND 69

  Fly    67 IFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123
            ||||||.||||||||||||||||||||||||||||||||||||||||||||||||:|
  Rat    70 IFERIANEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33910NP_001027283.1 H2B 33..121 CDD:197718 83/87 (95%)
Hist2h2beXP_227459.1 H2B 28..124 CDD:197718 89/95 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4523
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H128594
Inparanoid 1 1.050 191 1.000 Inparanoid score I3779
OMA 1 1.010 - - QHG53922
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 1 1.000 - - otm44705
orthoMCL 1 0.900 - - OOG6_100082
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X77
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.