DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33764 and CG14518

DIOPT Version :9

Sequence 1:NP_001027107.1 Gene:CG33764 / 3772289 FlyBaseID:FBgn0053764 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:161 Identity:51/161 - (31%)
Similarity:85/161 - (52%) Gaps:20/161 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VVKFTNIQCQSLDRDFALFDSWFLKSVNRSYKYVSVKVKLLKIPVSKVKVRFGLYKRVNGYMPFL 89
            :.|.||..|::.::.:..|....|::|:|:...::|...||. ||..|.|:..|.||.|||.|:|
  Fly    24 IFKMTNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLLH-PVHDVIVKARLLKRANGYKPWL 87

  Fly    90 YNMSFDACRFLTSPNPNPVALYFYNFFKDYSNINHSCPF-------DHDIILDKMPYHSINNKVT 147
            |::|||.|:|:...| |.:....:..||:||.|||:||:       :..:..:|:|         
  Fly    88 YSVSFDGCQFIRRRN-NALIRIVWELFKEYSTINHTCPYVGLQQVKNFYLRSEKLP--------- 142

  Fly   148 KILPFPEGKYMIEMHWIAYDIDRAITKFYWT 178
              .|.|.|:|::.:.|:.....:|.|..|:|
  Fly   143 --TPIPTGEYLLMIDWVFNKKPQAATNVYFT 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33764NP_001027107.1 DUF1091 74..159 CDD:284008 32/91 (35%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 31/101 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472621
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.