DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33764 and CG14518

DIOPT Version :10

Sequence 1:NP_001027107.1 Gene:CG33764 / 3772289 FlyBaseID:FBgn0053764 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:161 Identity:51/161 - (31%)
Similarity:85/161 - (52%) Gaps:20/161 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VVKFTNIQCQSLDRDFALFDSWFLKSVNRSYKYVSVKVKLLKIPVSKVKVRFGLYKRVNGYMPFL 89
            :.|.||..|::.::.:..|....|::|:|:...::|...||. ||..|.|:..|.||.|||.|:|
  Fly    24 IFKMTNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLLH-PVHDVIVKARLLKRANGYKPWL 87

  Fly    90 YNMSFDACRFLTSPNPNPVALYFYNFFKDYSNINHSCPF-------DHDIILDKMPYHSINNKVT 147
            |::|||.|:|:...| |.:....:..||:||.|||:||:       :..:..:|:|         
  Fly    88 YSVSFDGCQFIRRRN-NALIRIVWELFKEYSTINHTCPYVGLQQVKNFYLRSEKLP--------- 142

  Fly   148 KILPFPEGKYMIEMHWIAYDIDRAITKFYWT 178
              .|.|.|:|::.:.|:.....:|.|..|:|
  Fly   143 --TPIPTGEYLLMIDWVFNKKPQAATNVYFT 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33764NP_001027107.1 DUF1091 74..159 CDD:461928 32/91 (35%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 31/101 (31%)

Return to query results.
Submit another query.