DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33764 and CG14456

DIOPT Version :9

Sequence 1:NP_001027107.1 Gene:CG33764 / 3772289 FlyBaseID:FBgn0053764 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster


Alignment Length:92 Identity:25/92 - (27%)
Similarity:43/92 - (46%) Gaps:11/92 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 VKVRFGLYKRVNGYMPFLYNMSFDACRFLTSPNPNPVALYFYNFFKDYSNINHSCPFDHDIILDK 136
            |:||  :..:.:.|.....|.:.:.||.|...|.:||..:.:.|.:::.||..:||    |...:
  Fly    71 VEVR--ITNKQDPYYNTNLNTTLNVCRILGFANKSPVGRFVHGFIREFGNIVETCP----IAKGR 129

  Fly   137 MPYHSINNKVTKILPFPEGKYMIEMHW 163
            ..:|.|:.| .|:    :|.|.|...|
  Fly   130 YHWHRIHLK-RKL----QGSYFINKFW 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33764NP_001027107.1 DUF1091 74..159 CDD:284008 22/84 (26%)
CG14456NP_001137998.1 DM8 82..189 CDD:214778 22/79 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448129
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.