DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33764 and CG13590

DIOPT Version :9

Sequence 1:NP_001027107.1 Gene:CG33764 / 3772289 FlyBaseID:FBgn0053764 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_611919.1 Gene:CG13590 / 37907 FlyBaseID:FBgn0035012 Length:193 Species:Drosophila melanogaster


Alignment Length:175 Identity:51/175 - (29%)
Similarity:90/175 - (51%) Gaps:9/175 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KLNLFVASLILLTYYITEIYSVVKFTNIQCQSLDRDFALFDSWFLKSVNRSYKYVSVKVKLLKIP 68
            |:.:|..|| |:.|........:|.||..|:|.::.:.:.....||:.:|:...:::.|..:: |
  Fly     4 KVFIFAVSL-LVAYLSCGEAPYLKMTNAVCKSYNKSWVVVHYCRLKAYSRAKTSLNINVTFVE-P 66

  Fly    69 VSKVKVRFGLYKRVNGYMPFLYNMSFDACRFLTSPNPNPVALYFYNFFKDYSNINHSCPFDHDII 133
            ...:.|.|...|:.|||.|||::.:||||.|:...| .|||...:...::.|.|||:||::...:
  Fly    67 ARNISVHFKTMKKANGYKPFLFDYTFDACEFMRRRN-QPVAKIIWYMIRNVSTINHTCPYEGLQM 130

  Fly   134 LDKMPYHSINNKVTKILPFPEGKYMIEMHWIAYDIDRAITKFYWT 178
            |.  .:|.::..|    |.|.|.|::.:.|:.....:..|..|:|
  Fly   131 LS--DFHKVDIPV----PLPSGDYLLMVDWLFDGKTQFATNVYFT 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33764NP_001027107.1 DUF1091 74..159 CDD:284008 31/84 (37%)
CG13590NP_611919.1 DM8 83..171 CDD:214778 30/94 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472622
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.