DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33764 and CG13589

DIOPT Version :9

Sequence 1:NP_001027107.1 Gene:CG33764 / 3772289 FlyBaseID:FBgn0053764 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster


Alignment Length:171 Identity:48/171 - (28%)
Similarity:88/171 - (51%) Gaps:9/171 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FVASLILLTYYITEIYSVVKFTNIQCQSLDRDFALFDSWFLKSVNRSYKYVSVKVKLLKIPVSKV 72
            ||.| ::|.:.:.....:.|.||..|:|.::.:.:.....||:.:|:...:::....:: |...:
  Fly     8 FVVS-VILGFLVCGEAPLAKMTNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNINATFIE-PAKNI 70

  Fly    73 KVRFGLYKRVNGYMPFLYNMSFDACRFLTSPNPNPVALYFYNFFKDYSNINHSCPFDHDIILDKM 137
            .:...:.|:.|||.|||::.:||||.|:...| .|.|...:|..|:.|.:||:||::...:|.  
  Fly    71 YLHMKMMKKANGYKPFLFDYTFDACEFMRRRN-QPFAKIVWNMIKNVSTVNHTCPYEGLQMLS-- 132

  Fly   138 PYHSINNKVTKILPFPEGKYMIEMHWIAYDIDRAITKFYWT 178
            .:|.|:..|    |.|.|.|::.:.||.....:..|..|:|
  Fly   133 DFHHIDVPV----PLPSGDYLLLLDWIFDFKPQFATNVYFT 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33764NP_001027107.1 DUF1091 74..159 CDD:284008 30/84 (36%)
CG13589NP_611918.2 DM8 83..171 CDD:214778 32/94 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472612
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.