DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33764 and CG33923

DIOPT Version :9

Sequence 1:NP_001027107.1 Gene:CG33764 / 3772289 FlyBaseID:FBgn0053764 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster


Alignment Length:178 Identity:86/178 - (48%)
Similarity:129/178 - (72%) Gaps:7/178 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IKLNLFVASLILLTYYITEIYSVVKFTNIQCQSLDRDFALFDSWFLKSVNRSYKYVSVKVKLLKI 67
            ::|::|:       |...:....|:|.||:|.:||.:||.||..:||:|:|:|||:|::||||:.
  Fly     8 VQLSIFL-------YSFHQAVCKVEFANIKCVTLDPEFADFDYCYLKAVSRTYKYLSLRVKLLET 65

  Fly    68 PVSKVKVRFGLYKRVNGYMPFLYNMSFDACRFLTSPNPNPVALYFYNFFKDYSNINHSCPFDHDI 132
            |::|:|:...:.:|:|||.|||||::.|||:|..:...||:|.|.|:|||||||||||||:||||
  Fly    66 PITKIKINVAILQRLNGYKPFLYNVTIDACKFYKNQKSNPIARYLYSFFKDYSNINHSCPYDHDI 130

  Fly   133 ILDKMPYHSINNKVTKILPFPEGKYMIEMHWIAYDIDRAITKFYWTLT 180
            |::|:|...:|.:|||:||.|.|.|:...:|.||||:|||...|.|::
  Fly   131 IVEKLPISHVNTQVTKVLPVPHGDYLFHSNWYAYDINRAIVDVYATIS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33764NP_001027107.1 DUF1091 74..159 CDD:284008 47/84 (56%)
CG33923NP_001027216.2 DUF1091 72..157 CDD:284008 47/84 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472086
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.