DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33764 and CG33795

DIOPT Version :9

Sequence 1:NP_001027107.1 Gene:CG33764 / 3772289 FlyBaseID:FBgn0053764 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster


Alignment Length:171 Identity:58/171 - (33%)
Similarity:95/171 - (55%) Gaps:9/171 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NLFVASLILLTYYIT--EIYSVV-KFTNIQCQSLDRDFALFDSWFLKSVNRSYKYVSVKVKLLKI 67
            |:....:||:|:.:|  ..|||. |.||:.|:|.::.:...:...||:|||:....:... .:..
  Fly     3 NVLKIVVILVTFLLTWRLSYSVTYKLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNA-TIHH 66

  Fly    68 PVSKVKVRFGLYKRVNGYMPFLYNMSFDACRFLTSPNPNPVALYFYNFFKDYSNINHSCPFDHDI 132
            |.:.|.:.:...||.|||.|:||..:.|.||||..|. :.:....|..||.:|||||:|||..||
  Fly    67 PTNDVVIDYRFLKRENGYKPWLYKKNIDGCRFLRKPY-DMLTKMIYMVFKPFSNINHTCPFYGDI 130

  Fly   133 ILDKMPYHSINNKVTKILPFPEGKYMIEMHWIAYDIDRAIT 173
            ::..|   .:..:: |.:|:|.||||::::|..|...:.:|
  Fly   131 LIRGM---YLRTEI-KAMPYPSGKYMLQINWSFYKKIQVVT 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33764NP_001027107.1 DUF1091 74..159 CDD:284008 34/84 (40%)
CG33795NP_001027129.2 DUF1091 77..153 CDD:284008 34/80 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472619
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.