DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33764 and CG33766

DIOPT Version :9

Sequence 1:NP_001027107.1 Gene:CG33764 / 3772289 FlyBaseID:FBgn0053764 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027140.1 Gene:CG33766 / 3772380 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster


Alignment Length:134 Identity:27/134 - (20%)
Similarity:55/134 - (41%) Gaps:17/134 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QCQSLDRDFALFDSWFLKSVNRSYKYVSVKVKLLKIPVSKVKVRFGLYKRVNGY-MPFLYNMSFD 95
            ||.:.:|.:....:.|:|:...:.::..::|   .:|...:.:.|.:..: |.| ...::..:.|
  Fly    31 QCGNFNRSYFSNFTMFVKNSQMNMEFFLLRV---LVPGVTMDIEFFISMQ-NSYGFQKIFQYTLD 91

  Fly    96 ACRFLTSPNPNPVALYFYNFFKDYSNINHSCPFDHDIILDKMPYHSINNKVTKILPFPE----GK 156
            .|..|.....|....:|..|| |..|....||.:.:       ::.:.|.....|..|:    ||
  Fly    92 MCSLLAQRRNNMFKKWFATFF-DSGNFKKYCPVEPN-------FYYLKNYNYNTLFIPKFLYAGK 148

  Fly   157 YMIE 160
            |.::
  Fly   149 YRVK 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33764NP_001027107.1 DUF1091 74..159 CDD:284008 20/89 (22%)
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 20/91 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447809
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.