DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33764 and CG33770

DIOPT Version :9

Sequence 1:NP_001027107.1 Gene:CG33764 / 3772289 FlyBaseID:FBgn0053764 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster


Alignment Length:95 Identity:22/95 - (23%)
Similarity:35/95 - (36%) Gaps:12/95 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 KVRFGLYKRVNGYMPF--LYNMSFDACRFLTSPNPNPVALYFYNFFKDYSNINHSCPFD--HDII 133
            :.|.....||.....|  |::.|.|.|..:.:...|....::.|..| |.|....||.:  |..:
  Fly    73 RARLDFRTRVGNSKSFQSLFSTSIDVCNIVNAAKINLFKKWYKNLLK-YGNFLRQCPLNASHYYL 136

  Fly   134 LDKMPYHSINNKVTKILPF-PEGKYMIEMH 162
            .|......:      :.|| ..|.|.:|.:
  Fly   137 RDWQFGEGL------VPPFITSGSYRLETY 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33764NP_001027107.1 DUF1091 74..159 CDD:284008 21/89 (24%)
CG33770NP_001027144.2 DM8 88..178 CDD:214778 19/80 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448049
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.