DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33764 and CG33627

DIOPT Version :10

Sequence 1:NP_001027107.1 Gene:CG33764 / 3772289 FlyBaseID:FBgn0053764 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027406.1 Gene:CG33627 / 3772219 FlyBaseID:FBgn0053627 Length:183 Species:Drosophila melanogaster


Alignment Length:148 Identity:33/148 - (22%)
Similarity:60/148 - (40%) Gaps:49/148 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RDFALFDSWFL----KSVNRSY-KYVSVKVKLLKIPVSKVKVRFGLYKRVNGYMPFLYNMSFDAC 97
            :|.|.|::.|.    :..:||: |.:.|.|.:.:..           |.::|:            
  Fly    63 KDLAQFNATFKLFMPRKPSRSFQKVIDVNVDICQFA-----------KGIHGH------------ 104

  Fly    98 RFLTSPNPNPVALYFYNFFKDYSNINHSCPFDHDIILDKMPYHSINNKVTKILP--FPEGKYMIE 160
            ||:|        :....|.|..|.:  .||....:.:    |.:||  :.:.||  .||..:.||
  Fly   105 RFMT--------IVIKAFGKQGSQL--KCPHTKGLYV----YPNIN--IAENLPAFLPETDFKIE 153

  Fly   161 MHWI---AYDIDRAITKF 175
            |:::   |:.|:..:|.|
  Fly   154 MNFLSPAAHVINTTLTGF 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33764NP_001027107.1 DUF1091 74..159 CDD:461928 17/86 (20%)
CG33627NP_001027406.1 DUF1091 71..152 CDD:461928 23/119 (19%)

Return to query results.
Submit another query.