DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33764 and CG33648

DIOPT Version :9

Sequence 1:NP_001027107.1 Gene:CG33764 / 3772289 FlyBaseID:FBgn0053764 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027265.2 Gene:CG33648 / 3772188 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster


Alignment Length:170 Identity:72/170 - (42%)
Similarity:112/170 - (65%) Gaps:2/170 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LILLTYYITEIYSVVKFTNIQCQSLDRDFALFDSWFLKSVNRSYKYVSVKVKLLKIPVSKVKVRF 76
            ::::.|.|.:: |:|:||||:|.|.|..:..::|..:|||||:|||:||..:||.:|::...:..
  Fly    10 IVVILYGINDV-SIVEFTNIKCSSSDTSYVYYESCRIKSVNRTYKYISVNSRLLILPLTNATINV 73

  Fly    77 GLYKRVNGYMPFLYNMSFDACRFLTSPNPNPVALYFYNFFKDYSNI-NHSCPFDHDIILDKMPYH 140
            .||||.|||.|||||:|.||||||.:...|.|..|.::.....||| :.:|||:..|.:||:..:
  Fly    74 ALYKRYNGYKPFLYNVSVDACRFLRTQKSNIVVKYLFDLILLKSNIRSPTCPFNSFISVDKLTTN 138

  Fly   141 SINNKVTKILPFPEGKYMIEMHWIAYDIDRAITKFYWTLT 180
            .:|||:|::||.|||.|:....|.:|:|.|:....|.|::
  Fly   139 FLNNKLTQVLPVPEGDYLFAFRWFSYNIYRSSVNVYITIS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33764NP_001027107.1 DUF1091 74..159 CDD:284008 41/85 (48%)
CG33648NP_001027265.2 DUF1091 71..157 CDD:284008 41/85 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472087
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.