DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33764 and CG33798

DIOPT Version :9

Sequence 1:NP_001027107.1 Gene:CG33764 / 3772289 FlyBaseID:FBgn0053764 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027414.1 Gene:CG33798 / 3772108 FlyBaseID:FBgn0053798 Length:178 Species:Drosophila melanogaster


Alignment Length:174 Identity:91/174 - (52%)
Similarity:134/174 - (77%) Gaps:0/174 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFVASLILLTYYITEIYSVVKFTNIQCQSLDRDFALFDSWFLKSVNRSYKYVSVKVKLLKIPVSK 71
            :|....::..:.|.:::|:|:.||.:|:||||:|:.|:...||||||:|||:|:||.|.:.||::
  Fly     2 IFSVGFLVTIFLIRKVHSLVEITNFECESLDRNFSDFEYCRLKSVNRTYKYISLKVHLFQTPVNQ 66

  Fly    72 VKVRFGLYKRVNGYMPFLYNMSFDACRFLTSPNPNPVALYFYNFFKDYSNINHSCPFDHDIILDK 136
            :||...:|||:|||.|||||::.|.|:|:.:.|.|||..:.:..|||.:|:|||||:|||||::|
  Fly    67 IKVNTAIYKRLNGYKPFLYNVTVDGCKFIKNQNSNPVTKFIFGVFKDATNMNHSCPYDHDIIMEK 131

  Fly   137 MPYHSINNKVTKILPFPEGKYMIEMHWIAYDIDRAITKFYWTLT 180
            :...|||.::||||||||||||::|:|.||||:|||.:.|.|||
  Fly   132 LSAESINFQITKILPFPEGKYMVKMNWFAYDINRAIIRLYITLT 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33764NP_001027107.1 DUF1091 74..159 CDD:284008 48/84 (57%)
CG33798NP_001027414.1 DUF1091 69..154 CDD:284008 48/84 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472010
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.