DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33764 and CG33920

DIOPT Version :9

Sequence 1:NP_001027107.1 Gene:CG33764 / 3772289 FlyBaseID:FBgn0053764 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster


Alignment Length:176 Identity:85/176 - (48%)
Similarity:128/176 - (72%) Gaps:7/176 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VASLILLTYYITEIYSVVKFTNIQCQSLDRDFALFDSWFLKSVNRSYKYVSVKVKLLKIPVSKVK 73
            :.:|:.|:..|.||.|..:||||.|.|||:.|:.|:..::|||||||||||:|.||.|.|::|:.
  Fly     8 LVALLALSISIVEISSKFEFTNIMCNSLDKQFSDFEYCYIKSVNRSYKYVSIKAKLFKTPITKIN 72

  Fly    74 ----VRFGLYKRVNGYMPFLYNMSFDACRFLTSPNPNPVALYFYNFFKDYSNINHSCPFDHDIIL 134
                .||..|   |||.||::|::.|||||:.:...||:|.|.|:|.:.::|:||:||:|||:::
  Fly    73 GVILKRFNGY---NGYRPFMFNITLDACRFMNNTKSNPIASYLYDFIRPFTNMNHNCPYDHDLVI 134

  Fly   135 DKMPYHSINNKVTKILPFPEGKYMIEMHWIAYDIDRAITKFYWTLT 180
            :|:|.|.:|::|||:||.|||.|:.|.:|:||||.||:.|.|.|::
  Fly   135 EKLPIHFVNHQVTKVLPVPEGDYLYETNWMAYDIRRAVVKVYGTIS 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33764NP_001027107.1 DUF1091 74..159 CDD:284008 41/84 (49%)
CG33920NP_001027214.1 DUF1091 71..158 CDD:284008 40/89 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
66.060

Return to query results.
Submit another query.