DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33764 and CG33453

DIOPT Version :10

Sequence 1:NP_001027107.1 Gene:CG33764 / 3772289 FlyBaseID:FBgn0053764 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_995888.1 Gene:CG33453 / 2768851 FlyBaseID:FBgn0053453 Length:175 Species:Drosophila melanogaster


Alignment Length:160 Identity:55/160 - (34%)
Similarity:98/160 - (61%) Gaps:11/160 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFVASLILLTYYITEIYSVVKFTNIQCQSLDRDFALFDSWFLKSVNRSYKYVSVKVKLLKIPVSK 71
            :|:|:|.|:: .::|..: :|.||:.|:|:::.:|:|....||:.:|:...:::....|. |.:.
  Fly    10 VFLAALFLIS-SVSEAPN-IKLTNVVCESINKSWAVFHYCRLKAYSRNKTSLNINATFLH-PTNN 71

  Fly    72 VKVRFGLYKRVNGYMPFLYNMSFDACRFLTSPNPNPVALYFYNFFKDYSNINHSCPFDHDIILDK 136
            |.:|..:.||::||.|||::::.|||:||...: |||...||:|.||||.:||:||:...::.| 
  Fly    72 VSLRLKMVKRLSGYKPFLFDVTIDACQFLRKRH-NPVIKMFYSFIKDYSTLNHTCPYGLQVVSD- 134

  Fly   137 MPYHSINNKVTKILPFPEGKYMIEMHWIAY 166
              ||:....|    |.|.|.|.:.:.:|.|
  Fly   135 --YHTAVFPV----PLPSGDYGVLLDFIFY 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33764NP_001027107.1 DUF1091 74..159 CDD:461928 35/84 (42%)
CG33453NP_995888.1 DUF1091 78..149 CDD:461928 33/78 (42%)

Return to query results.
Submit another query.