DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33764 and CG33454

DIOPT Version :9

Sequence 1:NP_001027107.1 Gene:CG33764 / 3772289 FlyBaseID:FBgn0053764 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_995887.1 Gene:CG33454 / 2768850 FlyBaseID:FBgn0053454 Length:173 Species:Drosophila melanogaster


Alignment Length:177 Identity:66/177 - (37%)
Similarity:99/177 - (55%) Gaps:23/177 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IKLNLFVASLILLTYYITEIYS---VVKFTNIQCQSLDRDFALFDSWFLKSVNRSYKYVSVKVKL 64
            |.|.:|||.:.|       :||   :||.||:.|:|.|:...:|....||:.:|:...:.:....
  Fly     6 IILGVFVAVVFL-------VYSDSAMVKMTNVVCESYDKSLTVFHYCRLKAYSRTKTSLHINATF 63

  Fly    65 LKIPVSKVKVRFGLYKRVNGYMPFLYNMSFDACRFLTSPNPNPVALYFYNFFKDYSNINHSCPFD 129
            |. |::.:.|||.:.||.|||.|||::::.|||:||..|| |||....||..||.||||||||:.
  Fly    64 LH-PINSISVRFQMLKRANGYKPFLFDITVDACQFLRKPN-NPVIKIVYNMIKDASNINHSCPYG 126

  Fly   130 HDIILDKMPYHSINNKVTKILPFPEGKYMIEMHWIAYDIDRAITKFY 176
            ..::.|   :|    :::..||||.|.|:..:.::.    ...||||
  Fly   127 TVVLND---FH----RISLPLPFPSGDYLSRLDFLI----NGKTKFY 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33764NP_001027107.1 DUF1091 74..159 CDD:284008 41/84 (49%)
CG33454NP_995887.1 DUF1091 72..148 CDD:284008 40/83 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472618
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.