powered by:
Protein Alignment CG33774 and ostf-4
DIOPT Version :9
Sequence 1: | NP_001027396.1 |
Gene: | CG33774 / 3772288 |
FlyBaseID: | FBgn0053774 |
Length: | 40 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001367095.1 |
Gene: | ostf-4 / 3565877 |
WormBaseID: | WBGene00011558 |
Length: | 35 |
Species: | Caenorhabditis elegans |
Alignment Length: | 31 |
Identity: | 18/31 - (58%) |
Similarity: | 26/31 - (83%) |
Gaps: | 0/31 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MITDVQLAIFSNVLGVFLFLLVVAYHYINAN 31
||:||||.|.:|:||:.:.:|||.:||:|||
Worm 1 MISDVQLGIAANILGIAMLMLVVLFHYLNAN 31
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33774 | NP_001027396.1 |
Ost4 |
1..34 |
CDD:402012 |
18/31 (58%) |
ostf-4 | NP_001367095.1 |
Ost4 |
1..34 |
CDD:402012 |
18/31 (58%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
44 |
1.000 |
Domainoid score |
I8381 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
43 |
1.000 |
Inparanoid score |
I4147 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0005206 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto18395 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_108787 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X5583 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
8 | 7.860 |
|
Return to query results.
Submit another query.