DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33774 and ostf-4

DIOPT Version :9

Sequence 1:NP_001027396.1 Gene:CG33774 / 3772288 FlyBaseID:FBgn0053774 Length:40 Species:Drosophila melanogaster
Sequence 2:NP_001367095.1 Gene:ostf-4 / 3565877 WormBaseID:WBGene00011558 Length:35 Species:Caenorhabditis elegans


Alignment Length:31 Identity:18/31 - (58%)
Similarity:26/31 - (83%) Gaps:0/31 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MITDVQLAIFSNVLGVFLFLLVVAYHYINAN 31
            ||:||||.|.:|:||:.:.:|||.:||:|||
 Worm     1 MISDVQLGIAANILGIAMLMLVVLFHYLNAN 31

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33774NP_001027396.1 Ost4 1..34 CDD:402012 18/31 (58%)
ostf-4NP_001367095.1 Ost4 1..34 CDD:402012 18/31 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I8381
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I4147
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005206
OrthoInspector 1 1.000 - - oto18395
orthoMCL 1 0.900 - - OOG6_108787
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5583
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.