DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33774 and AT3G09455

DIOPT Version :9

Sequence 1:NP_001027396.1 Gene:CG33774 / 3772288 FlyBaseID:FBgn0053774 Length:40 Species:Drosophila melanogaster
Sequence 2:NP_001327668.1 Gene:AT3G09455 / 28719217 AraportID:AT3G09455 Length:35 Species:Arabidopsis thaliana


Alignment Length:31 Identity:15/31 - (48%)
Similarity:23/31 - (74%) Gaps:0/31 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MITDVQLAIFSNVLGVFLFLLVVAYHYINAN 31
            |..|..|..|:|.||:|:|:||:|||::.|:
plant     1 MFDDQDLGFFANFLGIFIFILVIAYHFVMAD 31

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33774NP_001027396.1 Ost4 1..34 CDD:402012 15/31 (48%)
AT3G09455NP_001327668.1 Ost4 1..33 CDD:402012 15/31 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108787
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.