powered by:
Protein Alignment CG33774 and AT3G09455
DIOPT Version :9
Sequence 1: | NP_001027396.1 |
Gene: | CG33774 / 3772288 |
FlyBaseID: | FBgn0053774 |
Length: | 40 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001327668.1 |
Gene: | AT3G09455 / 28719217 |
AraportID: | AT3G09455 |
Length: | 35 |
Species: | Arabidopsis thaliana |
Alignment Length: | 31 |
Identity: | 15/31 - (48%) |
Similarity: | 23/31 - (74%) |
Gaps: | 0/31 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MITDVQLAIFSNVLGVFLFLLVVAYHYINAN 31
|..|..|..|:|.||:|:|:||:|||::.|:
plant 1 MFDDQDLGFFANFLGIFIFILVIAYHFVMAD 31
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33774 | NP_001027396.1 |
Ost4 |
1..34 |
CDD:402012 |
15/31 (48%) |
AT3G09455 | NP_001327668.1 |
Ost4 |
1..33 |
CDD:402012 |
15/31 (48%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0005206 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_108787 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.810 |
|
Return to query results.
Submit another query.