DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33774 and ost4

DIOPT Version :9

Sequence 1:NP_001027396.1 Gene:CG33774 / 3772288 FlyBaseID:FBgn0053774 Length:40 Species:Drosophila melanogaster
Sequence 2:NP_001289672.1 Gene:ost4 / 100534615 ZFINID:ZDB-GENE-110307-1 Length:37 Species:Danio rerio


Alignment Length:34 Identity:24/34 - (70%)
Similarity:28/34 - (82%) Gaps:0/34 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MITDVQLAIFSNVLGVFLFLLVVAYHYINANTGK 34
            |:||||||||:|:|||.||||||.|||:..|..|
Zfish     1 MVTDVQLAIFANMLGVSLFLLVVLYHYVAVNNPK 34

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33774NP_001027396.1 Ost4 1..34 CDD:402012 23/32 (72%)
ost4NP_001289672.1 Ost4 1..34 CDD:402012 23/32 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11634
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5458
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005206
OrthoInspector 1 1.000 - - oto39428
orthoMCL 1 0.900 - - OOG6_108787
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4707
SonicParanoid 1 1.000 - - X5583
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.