powered by:
Protein Alignment CG33774 and Ost4
DIOPT Version :9
Sequence 1: | NP_001027396.1 |
Gene: | CG33774 / 3772288 |
FlyBaseID: | FBgn0053774 |
Length: | 40 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001128162.1 |
Gene: | Ost4 / 100188932 |
RGDID: | 2300150 |
Length: | 37 |
Species: | Rattus norvegicus |
Alignment Length: | 34 |
Identity: | 25/34 - (73%) |
Similarity: | 28/34 - (82%) |
Gaps: | 0/34 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MITDVQLAIFSNVLGVFLFLLVVAYHYINANTGK 34
||||||||||:|:|||.||||||.|||:..|..|
Rat 1 MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPK 34
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33774 | NP_001027396.1 |
Ost4 |
1..34 |
CDD:402012 |
24/32 (75%) |
Ost4 | NP_001128162.1 |
Ost4 |
1..34 |
CDD:402012 |
24/32 (75%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
51 |
1.000 |
Domainoid score |
I11319 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
52 |
1.000 |
Inparanoid score |
I5365 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0005206 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto98695 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_108787 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
1 |
1.000 |
- |
- |
|
X5583 |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
9 | 8.860 |
|
Return to query results.
Submit another query.