DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm-4 and Commd5

DIOPT Version :9

Sequence 1:NP_001027237.1 Gene:LSm-4 / 3772280 FlyBaseID:FBgn0067622 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_079812.1 Gene:Commd5 / 66398 MGIID:1913648 Length:224 Species:Mus musculus


Alignment Length:194 Identity:41/194 - (21%)
Similarity:85/194 - (43%) Gaps:26/194 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LTKSMLRVLIQVSVHYIESKKSSSEVLSLA---------LNKLTNGGHEIPPNFCELFTMVFLTM 78
            |.:|..|.|:::.|..:..|.....|..|.         |..|..|.|.:              :
Mouse    43 LDRSTFRKLLKLVVGALHGKDCREAVQHLGASANLSEERLAVLLAGTHTL--------------L 93

  Fly    79 QIFLRYPKGVVKHHELRKCLMDDLNLTEEYVEDICKVLL-NHRDVLSKNFSDTKMDRVKMSKLQW 142
            |..||.|...:|....:..| .:|.:.::.:.|:..:.. :.|.:|............::|..:|
Mouse    94 QQALRLPPASLKPDAFQDEL-QELGIPQDMIGDLASLAFGSQRPLLDSVAQQQGSSLPRVSNFRW 157

  Fly   143 RINISLSLNTVQID-KPTIVLHFKLQNKEYRTLELPLSMFQQVRYNIALLLNELQSLQSRLALK 205
            |:::::|.:..... :|::::..||.:......|:|::.||::||::||:|.|:..|:.:...|
Mouse   158 RVDVAISTSAQSRSLQPSVLMQLKLTDGSAHRFEVPIAKFQELRYSVALVLKEMAELERKCERK 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm-4NP_001027237.1 HCaRG 22..196 CDD:284632 39/183 (21%)
Commd5NP_079812.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Commd5_HCaRG 115..224 CDD:240101 23/107 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834658
Domainoid 1 1.000 44 1.000 Domainoid score I12276
eggNOG 1 0.900 - - E1_295KW
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5461
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48482
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008039
OrthoInspector 1 1.000 - - oto93118
orthoMCL 1 0.900 - - OOG6_106615
Panther 1 1.100 - - LDO PTHR15666
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5085
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.830

Return to query results.
Submit another query.