DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm-4 and commd5

DIOPT Version :9

Sequence 1:NP_001027237.1 Gene:LSm-4 / 3772280 FlyBaseID:FBgn0067622 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001003553.1 Gene:commd5 / 445159 ZFINID:ZDB-GENE-040801-71 Length:205 Species:Danio rerio


Alignment Length:206 Identity:47/206 - (22%)
Similarity:92/206 - (44%) Gaps:43/206 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RVLIQVSVHYIESKKSSSEVLSLALNKLTN--GGHEIPPNFCELFTMVFLTMQIFLRYPKGVVKH 91
            ||..:|.:.|...|..:.|..:..|..:.:  ||.:.    ||...::         ...|::..
Zfish    11 RVPAEVDMLYKHLKNVNRETFTQILRAVVDAIGGQDC----CESVRVI---------SESGLISE 62

  Fly    92 HEL---------------------RKCLMDD---LNLTEEYVEDICKVLLNHRDVLSKNFSDTKM 132
            ..|                     ::...||   |.::||.:.||..|:..:|.. |.|..|...
Zfish    63 ESLNHVMAGLYALLKEALCQPSLKQEVFSDDLRALRISEELLADIVVVVFGNRQT-SMNVGDKHQ 126

  Fly   133 --DRVKMSKLQWRINISLSLNTV-QIDKPTIVLHFKLQNKEYRTLELPLSMFQQVRYNIALLLNE 194
              ...|:..|:||:::::|.::: :..:|:|::..||.:......|:|::.||::|||::|:|.|
Zfish   127 GPSLAKIEDLKWRVDVAISTSSLSRALQPSILMQMKLSDGHTHQFEVPVAKFQELRYNVSLILKE 191

  Fly   195 LQSLQSRLALK 205
            :..::.|..||
Zfish   192 MNDIEKRSILK 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm-4NP_001027237.1 HCaRG 22..196 CDD:284632 44/195 (23%)
commd5NP_001003553.1 Commd5_HCaRG 96..205 CDD:240101 32/108 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577663
Domainoid 1 1.000 48 1.000 Domainoid score I11932
eggNOG 1 0.900 - - E1_295KW
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5385
OMA 1 1.010 - - QHG48482
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008039
OrthoInspector 1 1.000 - - oto39147
orthoMCL 1 0.900 - - OOG6_106615
Panther 1 1.100 - - LDO PTHR15666
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5085
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.