DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm-4 and Commd9

DIOPT Version :9

Sequence 1:NP_001027237.1 Gene:LSm-4 / 3772280 FlyBaseID:FBgn0067622 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001028864.1 Gene:Commd9 / 295956 RGDID:1307706 Length:198 Species:Rattus norvegicus


Alignment Length:205 Identity:40/205 - (19%)
Similarity:77/205 - (37%) Gaps:57/205 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SVHYIE----SKKSSSEVL---------SLALNKLTNGGHEIPPNFCELFTMVFLTMQIFLRYPK 86
            |.|::.    .|.||.:|:         |.||:..|     :..|.|...::.....:..|:   
  Rat     6 SEHFVALQSLLKASSKDVVRQLCQESFSSSALHSKT-----LLDNTCSSLSVTQEEAEQLLQ--- 62

  Fly    87 GVVKHHELRKCLMDDLNLTEE----YVED--------ICKVLLNHRDVLSKNFSDTKMDRVKMSK 139
              ..||..|.....||:..|.    :.|:        :.|::|.|...........::...::..
  Rat    63 --ALHHFTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHISTWRTEAQANQISLPRLVD 125

  Fly   140 LQWRINISLSLNTV-QIDKPTIVLHFKLQ-------------------NKEYRTLELPLSMFQQV 184
            |.||::|..|.::: ::..||.:|..|:|                   :||  ||:..|....::
  Rat   126 LDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGEKPSISAVTVELSKE--TLDTMLDGLGRI 188

  Fly   185 RYNIALLLNE 194
            |..::.:.|:
  Rat   189 RDQLSAVANK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm-4NP_001027237.1 HCaRG 22..196 CDD:284632 40/205 (20%)
Commd9NP_001028864.1 Exo70 10..>146 CDD:281124 26/145 (18%)
Commd9 90..197 CDD:240105 19/108 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.