DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSm-4 and COMMD5

DIOPT Version :9

Sequence 1:NP_001027237.1 Gene:LSm-4 / 3772280 FlyBaseID:FBgn0067622 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001074472.1 Gene:COMMD5 / 28991 HGNCID:17902 Length:224 Species:Homo sapiens


Alignment Length:198 Identity:43/198 - (21%)
Similarity:85/198 - (42%) Gaps:42/198 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LTKSMLRVLIQVSVHYIESKKSSSEVLSLA---------LNKLTNGGHEIPPNFCELFTMVFLTM 78
            |.:|..|.|::..|..::.:.....|..|.         |..|..|.|.:              :
Human    43 LDRSTFRKLLKFVVSSLQGEDCREAVQRLGVSANLPEEQLGALLAGMHTL--------------L 93

  Fly    79 QIFLRYPKGVVKHHELRKCLMDDLNLTEEYVEDICKVLLNHRDVLSKNFSDTKMDRV-------- 135
            |..||.|...:|....|..| .:|.:.::.|.|:..|:...:..|        :|.|        
Human    94 QQALRLPPTSLKPDTFRDQL-QELCIPQDLVGDLASVVFGSQRPL--------LDSVAQQQGAWL 149

  Fly   136 -KMSKLQWRINISLSLNTVQID-KPTIVLHFKLQNKEYRTLELPLSMFQQVRYNIALLLNELQSL 198
             .::..:||:::::|.:.:... :|::::..||.:......|:|.:.||::||::||:|.|:..|
Human   150 PHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKEMADL 214

  Fly   199 QSR 201
            :.|
Human   215 EKR 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSm-4NP_001027237.1 HCaRG 22..196 CDD:284632 41/191 (21%)
COMMD5NP_001074472.1 Commd5_HCaRG 115..224 CDD:240101 25/111 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144535
Domainoid 1 1.000 44 1.000 Domainoid score I12353
eggNOG 1 0.900 - - E1_295KW
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I5487
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48482
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008039
OrthoInspector 1 1.000 - - oto89551
orthoMCL 1 0.900 - - OOG6_106615
Panther 1 1.100 - - LDO PTHR15666
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.