DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33862 and macroh2a1

DIOPT Version :9

Sequence 1:NP_001027381.1 Gene:His2A:CG33862 / 3772278 FlyBaseID:FBgn0053862 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001035451.1 Gene:macroh2a1 / 678613 ZFINID:ZDB-GENE-060421-4796 Length:357 Species:Danio rerio


Alignment Length:123 Identity:78/123 - (63%)
Similarity:91/123 - (73%) Gaps:2/123 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLEL 65
            ||.|  |||.|....|||.|||:.|||||:.|..|:|....|:..|||||:|||:|||.||:|||
Zfish     1 MSSR--GGKKKVSRGSRSARAGVIFPVGRMLRFFRRGLPKYRISVGAPVYMAAVLEYLTAEILEL 63

  Fly    66 AGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKK 123
            ||||||||||.|:.|||:.|||.|||||::||.||||:.|||||||...||.||.|.:
Zfish    64 AGNAARDNKKGRVTPRHILLAIANDEELHQLLRGVTISAGGVLPNIHPELLAKKRESR 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33862NP_001027381.1 PTZ00017 16..124 CDD:185399 71/108 (66%)
macroh2a1NP_001035451.1 H2A 5..117 CDD:238029 72/111 (65%)
Macro_H2A_like 170..349 CDD:239232
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.