DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33862 and H2AB1

DIOPT Version :9

Sequence 1:NP_001027381.1 Gene:His2A:CG33862 / 3772278 FlyBaseID:FBgn0053862 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001017990.1 Gene:H2AB1 / 474382 HGNCID:22516 Length:115 Species:Homo sapiens


Alignment Length:100 Identity:47/100 - (47%)
Similarity:67/100 - (67%) Gaps:2/100 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNA 69
            |.||  :|:..||:.||.|.|.|.::.|.||:|:||:|:...||||||||:|||.|:|.|||||.
Human    12 GAGG--RGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVPELAGNE 74

  Fly    70 ARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQ 104
            |:::.:..|.|..|.:.:.||..|:.|.:..||:|
Human    75 AQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQ 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33862NP_001027381.1 PTZ00017 16..124 CDD:185399 42/88 (48%)
H2AB1NP_001017990.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 4/10 (40%)
H2A 21..113 CDD:197711 42/88 (48%)
H2A 21..112 CDD:305064 42/88 (48%)
Docking domain. /evidence=ECO:0000269|PubMed:15257289 87..115 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.